Mouse Anti-7B2 Antibody (CBMOAB-00434FYA)


Cat: CBMOAB-00434FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00434FYA Monoclonal Fruit fly (Drosophila melanogaster), Pig (Sus scrofa) WB, ELISA MO00434FYA 100 µg
MO-AB-23431R Monoclonal Pig (Sus scrofa) WB, ELISA MO23431R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Pig (Sus scrofa)
CloneMO00434FYA
SpecificityThis antibody binds to fruit fly 7B2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster 7B2 Antibody is a mouse antibody against 7B2. It can be used for 7B2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names7B2, isoform B; 7B2
UniProt IDQ59E04
Protein RefseqThe length of the protein is 276 amino acids long.
The sequence is show below: MLFRSQTHVFPGVYMMVAMLVVALSGYQVQSYSAKDILADVLMTDLLNRMDKDMQVGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHPSLRDDEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPCPEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSADVGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAGYPVMPDPRLDDAVINPFLQGDRLPIAAKKGNLLFH.
For Research Use Only | Not For Clinical Use.
Online Inquiry