AibGenesis™ Mouse Anti-ARL8B Antibody (MO-AB-00680W)


Cat: MO-AB-00680W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00680W Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO00680W 100 µg
MO-AB-07604R Monoclonal Cattle (Bos taurus) WB, ELISA MO07604R 100 µg
MO-AB-14250Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14250Y 100 µg
MO-AB-19652W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19652W 100 µg
MO-AB-24174H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24174C 100 µg
MO-AB-51295W Monoclonal Marmoset WB, ELISA MO51295W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO00680W
SpecificityThis antibody binds to A. thaliana ARL8B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytoskeleton; Endosome; Vacuole; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay play a role in lysosome motility (PubMed:16537643, PubMed:25898167). May play a role in chromosome segregation (PubMed:15331635). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-A. thaliana ARL8B Antibody is a mouse antibody against ARL8B. It can be used for ARL8B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADP-ribosylation factor-like protein; ARL8B
UniProt IDQ9FJW7
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: MELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKVTKGSVTIKLWDLGGQPRFRSMWERYCRSVSAIVYVVDAADPDNLSVSKSELHDLLSKTSLNGIPLLVLGNKIDKPGALSKEALTDEMGLKSLTDREVCCFMISCKNSTNIDQVIDWLVKHSKSSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry