Mouse Anti-A4GALT Antibody (CBMOAB-34746FYA)


Cat: CBMOAB-34746FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34746FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO34746FYA 100 µg
MO-AB-24028W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24028W 100 µg
MO-AB-50150W Monoclonal Marmoset WB, ELISA MO50150W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO34746FYA
SpecificityThis antibody binds to Rhesus A4GALT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. This protein, a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Rhesus A4GALT Antibody is a mouse antibody against A4GALT. It can be used for A4GALT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesA4GALT
UniProt IDF6XXE8
Protein RefseqThe length of the protein is 436 amino acids long.
The sequence is show below: MSKPPDLLLRLLRGAPRQRVCALFIIGFKFTFFVSIMIYWHVVGEPKEQGQLYNLPADIPCPTLALPALPSHGPAPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLDLQELFRDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNMLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESHTCRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPQLFNATYAVHVWNKKSQGTRAGPAPCPLLPHDTQGHEDVLVRALRGHLPDPLLMGHLATLPGEARLGPRRGRPAATGLRLAVEELREQVQWEAMDTPRTVSCLEAGLTRGARACGVSSVSAPGLLDNRQEG.
For Research Use Only | Not For Clinical Use.
Online Inquiry