Mouse Anti-AADACL4 Antibody (CBMOAB-34754FYA)


Cat: CBMOAB-34754FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34754FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO34754FYA 100 µg
CBMOAB-64276FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64276FYA 100 µg
MO-AB-01112H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01112C 100 µg
MO-AB-03323W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03323W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO34754FYA
SpecificityThis antibody binds to Rhesus AADACL4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAADACL4 (Arylacetamide Deacetylase Like 4) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include hydrolase activity and carboxylic ester hydrolase activity. An important paralog of this gene is AADACL3.
Product OverviewMouse Anti-Rhesus AADACL4 Antibody is a mouse antibody against AADACL4. It can be used for AADACL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAADACL4
UniProt IDF6TK97
Protein RefseqThe length of the protein is 407 amino acids long.
The sequence is show below: MALPWLVLLLALPIFFLGVFVWAVFEHFLTTDVPATLQHPAKLRFLHCIFLYLITLGNIFEKLGICSMPKFIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHGGGTVFGSLDCYHGLCNYLARETDSVLLMIGYRKVPDHHSPALFQDCMNASIHFLKALETYGVDPSRVVVCGDSIGGAVVAAITQALVGRSDLPRIRAQVLIYPFVQAFCLQLPSYQQNQNVPFLSRKFLVTSVCNYLAIDLSWRDAILNGTCVPPDVWRKYEKWLSPDNIPKKFKNRGYQPWSPGPFNEAAYLEAKHMLDVENSPLIADDEVIAQLPESFLVSCENDILRDDSLLYKKRLEDQGVRVTWYHLEDGFHGSVIFFDKKALFFPCSLKIVNAVVSYVKGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry