Mouse Anti-AADAT Antibody (CBMOAB-34756FYA)


Cat: CBMOAB-34756FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34756FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO34756FYA 100 µg
MO-AB-21218W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21218W 100 µg
MO-AB-50156W Monoclonal Marmoset WB, ELISA MO50156W 100 µg
MO-AB-06729R Monoclonal Cattle (Bos taurus) WB, ELISA MO06729R 100 µg
MO-AB-01114H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01114C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO34756FYA
SpecificityThis antibody binds to Rhesus AADAT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus AADAT Antibody is a mouse antibody against AADAT. It can be used for AADAT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAADAT
UniProt IDF7H0V4
Protein RefseqThe length of the protein is 425 amino acids long.
The sequence is show below: MNYARFITAASAARNPSPIRTATEISSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIEFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTVHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDEHGIVPDSLRDILSRWKPEDSKNPQKNTPKFLYTVPSGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHDWGEEGFMAHVDRVTDFYSNQKDAILAAADKWLTVISEFYPKGHEHYFTTLHNSTEEKLLINSKFFFKKVLMLPGNAFYIDSSAPSPYLRASFSLSLKKKVSARAFQVLAQLIKESL.
For Research Use Only | Not For Clinical Use.
Online Inquiry