AibGenesis™ Mouse Anti-aamdc Antibody (CBMOAB-64282FYA)


Cat: CBMOAB-64282FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-64282FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO64282FYA 100 µg
CBMOAB-34759FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO34759FYA 100 µg
MO-AB-50161W Monoclonal Marmoset WB, ELISA MO50161W 100 µg
MO-AB-06733R Monoclonal Cattle (Bos taurus) WB, ELISA MO06733R 100 µg
MO-AB-23930H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23930C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO64282FYA
SpecificityThis antibody binds to Zebrafish aamdc.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish aamdc Antibody is a mouse antibody against aamdc. It can be used for aamdc detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMth938 domain-containing protein; aamd
UniProt IDQ502H1
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MSSPEIASLSWGHMKVKGCSTSYKDCKVWPGGSRAWDWRETGTNHHPGVQPSDLEEILRKGVQTLVIGRGMSEALQVPPSTLDYVKKQGVDVQVFQTEQAVREYNALAGKGEKVGGVFHSTC.
For Research Use Only | Not For Clinical Use.
Online Inquiry