Mouse Anti-AAMP Antibody (CBMOAB-34760FYA)


Cat: CBMOAB-34760FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34760FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Primat, Marmoset, Zebrafish (Danio rerio) WB, ELISA MO34760FYA 100 µg
CBMOAB-64286FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64286FYA 100 µg
MO-AB-01117H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01117C 100 µg
MO-AB-06734R Monoclonal Cattle (Bos taurus) WB, ELISA MO06734R 100 µg
MO-AB-16786W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16786W 100 µg
MO-AB-28767W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28767W 100 µg
MO-AB-50162W Monoclonal Marmoset WB, ELISA MO50162W 100 µg
MO-DKB-00883W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Primat, Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Primat, Marmoset, Zebrafish (Danio rerio)
CloneMO34760FYA
SpecificityThis antibody binds to Rhesus AAMP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Extracellular region or secreted; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via the RhoA pathway. The encoded protein can bind to heparin and may mediate heparin-sensitive cell adhesion. (From NCBI)
Product OverviewMouse Anti-Rhesus AAMP Antibody is a mouse antibody against AAMP. It can be used for AAMP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAAMP
UniProt IDF7CR28
Protein RefseqThe length of the protein is 347 amino acids long.
The sequence is show below: MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEGNEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVATNQDGSLILTGSVDCQAKLVSATTGKVSGPGARLGPPLSRLLSFLPGSSLSPLPTVFLSIKHPDSGPSSDPLWLSGGGCF.
For Research Use Only | Not For Clinical Use.
Online Inquiry