Mouse Anti-ABCD1 Antibody (MO-AB-06758R)
Cat: MO-AB-06758R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-06758R | Monoclonal | Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO06758R | 100 µg | ||
CBMOAB-34836FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO34836FYA | 100 µg | ||
CBMOAB-64395FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64395FYA | 100 µg | ||
MO-AB-21988W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21988W | 100 µg | ||
MO-AB-07046Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07046Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO06758R |
Specificity | This antibody binds to Cattle ABCD1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Peroxisome; Lysosome; Endoplasmic reticulum; Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein is likely involved in the peroxisomal transport or catabolism of very long chain fatty acids. Defects in this gene have been identified as the underlying cause of adrenoleukodystrophy, an X-chromosome recessively inherited demyelinating disorder of the nervous system. |
Product Overview | Mouse Anti-Cattle ABCD1 Antibody is a mouse antibody against ABCD1. It can be used for ABCD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-binding cassette, sub-family D (ALD), member 1; ABCD1 |
UniProt ID | Q2KJ57 |
Protein Refseq | The length of the protein is 737 amino acids long. The sequence is show below: MTVLSTPRASRVTTLKRTAVVLALVAYGAHKLYPLVRQCLAPARGPQAPAVEGEPTPDVSGAPVASAGKAGVNQVFLQRLLWLLRLLFPRILCRETGLLALHSAALVSRTFLSVYVARLDGRLARCIVRKDPQAFSWQLVQWLLIALPATFINSAIRYLEGQLALAFRSRLVAHAYSLYFSQQTYYRVSNMDGRLRNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTTYTLVRAARSRGAGTAWPSAIAGLV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry