Mouse Anti-ABCD1 Antibody (MO-AB-06758R)


Cat: MO-AB-06758R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06758R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO06758R 100 µg
CBMOAB-34836FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO34836FYA 100 µg
CBMOAB-64395FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64395FYA 100 µg
MO-AB-21988W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21988W 100 µg
MO-AB-07046Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07046Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO06758R
SpecificityThis antibody binds to Cattle ABCD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Lysosome; Endoplasmic reticulum; Mitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein is likely involved in the peroxisomal transport or catabolism of very long chain fatty acids. Defects in this gene have been identified as the underlying cause of adrenoleukodystrophy, an X-chromosome recessively inherited demyelinating disorder of the nervous system. (From NCBI)
Product OverviewMouse Anti-Cattle ABCD1 Antibody is a mouse antibody against ABCD1. It can be used for ABCD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette, sub-family D (ALD), member 1; ABCD1
UniProt IDQ2KJ57
Protein RefseqThe length of the protein is 737 amino acids long.
The sequence is show below: MTVLSTPRASRVTTLKRTAVVLALVAYGAHKLYPLVRQCLAPARGPQAPAVEGEPTPDVSGAPVASAGKAGVNQVFLQRLLWLLRLLFPRILCRETGLLALHSAALVSRTFLSVYVARLDGRLARCIVRKDPQAFSWQLVQWLLIALPATFINSAIRYLEGQLALAFRSRLVAHAYSLYFSQQTYYRVSNMDGRLRNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTTYTLVRAARSRGAGTAWPSAIAGLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry