Mouse Anti-ABHD14B Antibody (MO-AB-20001W)


Cat: MO-AB-20001W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20001W Monoclonal Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO20001W 100 µg
CBMOAB-34862FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO34862FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO20001W
SpecificityThis antibody binds to Chimpanzee ABHD14B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHas hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.
Product OverviewMouse Anti-Chimpanzee ABHD14B Antibody is a mouse antibody against ABHD14B. It can be used for ABHD14B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAbhydrolase domain containing 14B; ABHD14B
UniProt IDK6ZB01
Protein RefseqThe length of the protein is 243 amino acids long.
The sequence is show below: MLLWDCHPGQGVLWPLIIVALNHRPFTSTAAAGMAASVEQREGTIQVQGQALFFREALPESGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGRSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGYVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry