Mouse Anti-ABHD14B Antibody (MO-AB-50225W)


Cat: MO-AB-50225W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-50225W Monoclonal Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO50225W 100 µg
CBMOAB-34862FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO34862FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Rhesus (Macaca mulatta)
CloneMO50225W
SpecificityThis antibody binds to Marmoset ABHD14B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHas hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.
Product OverviewMouse Anti-Marmoset ABHD14B Antibody is a mouse antibody against ABHD14B. It can be used for ABHD14B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAbhydrolase domain-containing protein 14B isoform 1; ABHD14B
UniProt IDF7I5W3
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: MAANVEQREGTIQVQGQGLFFREARPGSGQVRFSVLLLHGIRFSSETWQNLGTLRRLAQAGYQAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLRGYVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLE.
For Research Use Only | Not For Clinical Use.
Online Inquiry