Mouse Anti-ABHD3 Antibody (MO-AB-06800R)


Cat: MO-AB-06800R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06800R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO06800R 100 µg
MO-AB-22278W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22278W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO06800R
SpecificityThis antibody binds to Cattle ABHD3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a very wide range of enzymes. The function of this protein has not been determined.
Product OverviewMouse Anti-Cattle ABHD3 Antibody is a mouse antibody against ABHD3. It can be used for ABHD3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAbhydrolase domain-containing protein 3; EC 3.1.1.-; ABHD3
UniProt IDQ0VC00
Protein RefseqThe length of the protein is 411 amino acids long.
The sequence is show below: MQRLAMDLRMLSRELSHYLEHQVRVGFFGSGVGFSLILGFSVAYACYYLSSIAKKPQLVTGGESFSRFLQDHCPVVTETYYPTVWCWESRGQTLLRPFITSKPLVQYRNELIKTADGGQISLDWFDNDNSKHYMDASTRPTVLLLPGLTGTSKESYILHMIHLSEELGYRYVVFNNRGVAGENLLTPRTYCCSNTEDLETVIHHVHSLYPSAPFLAAGVSMGGMLLLNYLGKIGPKTPLKAAATFSVGWNTFACS.
For Research Use Only | Not For Clinical Use.
Online Inquiry