Mouse Anti-ABI3BP Antibody (CBMOAB-34880FYA)


Cat: CBMOAB-34880FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34880FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO34880FYA 100 µg
MO-AB-03332W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03332W 100 µg
MO-AB-06812R Monoclonal Cattle (Bos taurus) WB, ELISA MO06812R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO34880FYA
SpecificityThis antibody binds to Rhesus ABI3BP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ABI3BP Antibody is a mouse antibody against ABI3BP. It can be used for ABI3BP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTarget of Nesh-SH3; ABI3BP
UniProt IDH9FKH4
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: NLKPNTSYEFQVKPKNPLGEGPVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFDSDSYSECKGKQYVKRTWYKKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDH.
For Research Use Only | Not For Clinical Use.
Online Inquiry