Mouse Anti-ABLIM3 Antibody (MO-AB-06815R)


Cat: MO-AB-06815R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06815R Monoclonal Cattle (Bos taurus), Rhesus (Macaca mulatta) WB, ELISA MO06815R 100 µg
CBMOAB-34893FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO34893FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rhesus (Macaca mulatta)
CloneMO06815R
SpecificityThis antibody binds to Cattle ABLIM3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the actin-binding LIM (abLIM) family of proteins. These proteins are characterized by an N-terminal LIM domain and a C-terminal dematin-like domain. The encoded protein interacts with actin filaments and may be a component of adherens junctions in several cell types. A variant of this gene may be associated with pain sensitivity in male human patients.
Product OverviewMouse Anti-Cattle ABLIM3 Antibody is a mouse antibody against ABLIM3. It can be used for ABLIM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABLIM3 protein; ABLIM3
UniProt IDA5PKK3
Protein RefseqThe length of the protein is 683 amino acids long.
The sequence is show below: MNTSLPYQQNPYSPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCKKPFPIGDKVTFSGKECLCQTCSQSMTSSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHSQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry