AibGenesis™ Mouse Anti-abracl Antibody (CBMOAB-64532FYA)
Cat: CBMOAB-64532FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-64532FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO64532FYA | 100 µg | ||
| MO-AB-06818R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06818R | 100 µg | ||
| MO-AB-21183W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21183W | 100 µg | ||
| MO-AB-23953H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO23953C | 100 µg | ||
| MO-AB-50272W | Monoclonal | Marmoset | WB, ELISA | MO50272W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO64532FYA |
| Specificity | This antibody binds to Zebrafish abracl. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish abracl Antibody is a mouse antibody against abracl. It can be used for abracl detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Costars family protein ABRACL; ABRA C-terminal-like protein; abrac |
| UniProt ID | Q6TGV7 |
| Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: MNVEHEVSLLIDEIRRLGSKNADGKTSVKFGVLFNDDQCANLFEALVGTLKAAKRKKVITFDGELLLQGVHDNVDVVLLQD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry