AibGenesis™ Mouse Anti-acbd4 Antibody (CBMOAB-64601FYA)


Cat: CBMOAB-64601FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-64601FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO64601FYA 100 µg
MO-AB-00900W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO00900W 100 µg
MO-AB-06861R Monoclonal Cattle (Bos taurus) WB, ELISA MO06861R 100 µg
MO-AB-18449W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18449W 100 µg
MO-AB-50301W Monoclonal Marmoset WB, ELISA MO50301W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO64601FYA
SpecificityThis antibody binds to Zebrafish acbd4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish acbd4 Antibody is a mouse antibody against acbd4. It can be used for acbd4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesacbd4; Acyl-CoA Binding Domain Containing 4
UniProt IDE7F6L9
Protein RefseqThe length of the protein is 404 amino acids long.
The sequence is show below: MRHALTMSEIEDCQRRFQAAVDVIQSLPKNGTYKPSYEVMLRFYGLFKQAVCGPCTLSRPGFWDPVGRYKWEAWSNLGEMSRETAMAAYVDEMKKVAQDVIDTMQINEKNASYFHYFEPLYHVIHDMPRPPEALFSLSSDVNVKEPTGDVFKHNVDSATQEPRLQQDTETSLNSELQPQSTEQRMSECQGPISDTESEVFCDSLEQMDNIKLTAVPDGNSPFQNGRTCIEISGIQESHYSAPSQLVQIGVGHGEGAEDRHDPPMRMTTAGREWLQQNWRDSPGFMAHHSAGRLSAAGSGQGDRDNSKSGSGRLQQQIFLALRKLREDMQSVMERLDVVESLATANAQNSHWISHLQRTAGESEEKWWPFEISGRTLMLLLVWPFVTQWLSFLLRWKKRQIHGCI.
For Research Use Only | Not For Clinical Use.
Online Inquiry