AibGenesis™ Mouse Anti-ACBP Antibody (CBMOAB-18463FYB)
Cat: CBMOAB-18463FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-18463FYB | Monoclonal | Rice (Oryza), Arabidopsis (Arabidopsis lyrata), Grape (Vitis vinifera), O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO18463FYB | 100 µg | ||
| MO-AB-00013H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00013C | 100 µg | ||
| MO-AB-10598Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10598Y | 100 µg | ||
| MO-AB-38809W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO38809W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rice (Oryza), Arabidopsis (Arabidopsis lyrata), Grape (Vitis vinifera), O. mykiss (Oncorhynchus mykiss) |
| Clone | MO18463FYB |
| Specificity | This antibody binds to Rice ACBP. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rice ACBP Antibody is a mouse antibody against ACBP. It can be used for ACBP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Acyl-CoA-binding protein; ACBP |
| UniProt ID | Q8L823 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MGLQEDFEQYAEKGRPCRRALATRTSLSSMDSTSRPPLEMSILLVLAYSPRGTGRNGMHGKLLKANRRRKQLSDYITKVKQLLEEACCLQLL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry