Mouse Anti-acer3 Antibody (CBMOAB-64627FYA)


Cat: CBMOAB-64627FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-64627FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO64627FYA 100 µg
MO-AB-01169H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01169C 100 µg
MO-AB-06881R Monoclonal Cattle (Bos taurus) WB, ELISA MO06881R 100 µg
MO-AB-12906W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12906W 100 µg
MO-AB-50310W Monoclonal Marmoset WB, ELISA MO50310W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO64627FYA
SpecificityThis antibody binds to Zebrafish acer3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish acer3 Antibody is a mouse antibody against acer3. It can be used for acer3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesacer3; si:ch211-30e10.5; Alkaline Ceramidase 3
UniProt IDE9QEA6
Protein RefseqThe length of the protein is 265 amino acids long.
The sequence is show below: MAPAADRPGYWGTPTSTLDWCEENYVVSYYIAEFWNTVSNLIMILPPIYGAIQTCRDGLEVRYVWSFLGLAAVGIGSWSFHMTLQYEMQLLDELPMIYSCCVFVYCLYECFKQERAVNYFSIILLLTFSIIVSVIYLLWKEPVFHQVMYAVLVAFLVIRSVFIVTWVYPWLRALGFTSLSVFLLGFVLWNIDNMMCDSLRSARQQLPPVVGAVTQLHAWWHILTGLGSYLHILLSLQIRSTYLKHRPKVKFLCGVWPMLHIESQK.
For Research Use Only | Not For Clinical Use.
Online Inquiry