AibGenesis™ Mouse Anti-Acj6 Antibody (CBMOAB-00548FYA)


Cat: CBMOAB-00548FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00548FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster) WB, ELISA MO00548FYA 100 µg
MO-NAB-00695W Monoclonal D. melanogaster (Drosophila melanogaster) IF, IHC, WB NW0617 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster)
CloneMO00548FYA
SpecificityThis antibody binds to fruit fly Acj6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Acj6 Antibody is a mouse antibody against Acj6. It can be used for Acj6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPOU domain protein; acj6
UniProt IDB7Z0Y6
Protein RefseqThe length of the protein is 364 amino acids long.
The sequence is show below: MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY.
For Research Use Only | Not For Clinical Use.
Online Inquiry