Mouse Anti-ACMSD Antibody (CBMOAB-34960FYA)


Cat: CBMOAB-34960FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34960FYA Monoclonal Rhesus (Macaca mulatta), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO34960FYA 100 µg
CBMOAB-64655FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64655FYA 100 µg
CBMOAB-00290HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO00290HB 100 µg
MO-AB-06892R Monoclonal Cattle (Bos taurus) WB, ELISA MO06892R 100 µg
MO-AB-23479R Monoclonal Pig (Sus scrofa) WB, ELISA MO23479R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO34960FYA
SpecificityThis antibody binds to Rhesus ACMSD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS.
Product OverviewMouse Anti-Rhesus ACMSD Antibody is a mouse antibody against ACMSD. It can be used for ACMSD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACMSD
UniProt IDF7HFG7
Protein RefseqThe length of the protein is 312 amino acids long.
The sequence is show below: MKIDIHSHILPKEWPDLKKRFGYEGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLATTVASYPRRFVGLGTLPMQAPELAVQEMERCVKELGFPGVQIGTHVNEWDLNARELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKVSPVCHLDGLWGAECYISNPSSLLFWPLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry