AibGenesis™ Mouse Anti-ACP1 Antibody (CBMOAB-00110CR)
Cat: CBMOAB-00110CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00110CR | Monoclonal | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO00110CR | 100 µg | ||
| CBMOAB-00568FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO00568FYA | 100 µg | ||
| CBMOAB-1540FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO1540FC | 100 µg | ||
| CBMOAB-64695FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64695FYA | 100 µg | ||
| MO-AB-00919W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO00919W | 100 µg | ||
| MO-AB-01188H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01188C | 100 µg | ||
| MO-AB-06910R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06910R | 100 µg | ||
| MO-AB-11803W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11803W | 100 µg | ||
| MO-AB-23964H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO23964C | 100 µg | ||
| MO-AB-36661W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36661W | 100 µg | ||
| MO-AB-50341W | Monoclonal | Marmoset | WB, ELISA | MO50341W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO00110CR |
| Specificity | This antibody binds to Yeast ACP1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Carrier of the growing fatty acid chain in fatty acid biosynthesis. May be involved in the synthesis of very-long-chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast ACP1 Antibody is a mouse antibody against ACP1. It can be used for ACP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Acyl carrier protein, mitochondrial; ACP; NADH-ubiquinone oxidoreductase 9.6 kDa subunit; ACP1; YKL192C |
| UniProt ID | P32463 |
| Protein Refseq | The length of the protein is 125 amino acids long. The sequence is show below: MFRSVCRISSRVAPSAYRTIMGRSVMSNTILAQRFYSANLSKDQVSQRVIDVIKAFDKNSPNIANKQISSDTQFHKDLGLDSLDTVELLVAIEEEFDIEIPDKVADELRSVGETVDYIASNPDAN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry