Mouse Anti-ACP1 Antibody (CBMOAB-00110CR)
Cat: CBMOAB-00110CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00110CR | Monoclonal | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO00110CR | 100 µg | ||
CBMOAB-00568FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO00568FYA | 100 µg | ||
CBMOAB-1540FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO1540FC | 100 µg | ||
CBMOAB-64695FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64695FYA | 100 µg | ||
MO-AB-00919W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO00919W | 100 µg | ||
MO-AB-01188H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01188C | 100 µg | ||
MO-AB-06910R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06910R | 100 µg | ||
MO-AB-11803W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11803W | 100 µg | ||
MO-AB-23964H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO23964C | 100 µg | ||
MO-AB-36661W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36661W | 100 µg | ||
MO-AB-50341W | Monoclonal | Marmoset | WB, ELISA | MO50341W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO00110CR |
Specificity | This antibody binds to Yeast ACP1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of very-long-chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity). |
Product Overview | Mouse Anti-Yeast ACP1 Antibody is a mouse antibody against ACP1. It can be used for ACP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Acyl carrier protein, mitochondrial; ACP; NADH-ubiquinone oxidoreductase 9.6 kDa subunit; ACP1; YKL192C |
UniProt ID | P32463 |
Protein Refseq | The length of the protein is 125 amino acids long. The sequence is show below: MFRSVCRISSRVAPSAYRTIMGRSVMSNTILAQRFYSANLSKDQVSQRVIDVIKAFDKNSPNIANKQISSDTQFHKDLGLDSLDTVELLVAIEEEFDIEIPDKVADELRSVGETVDYIASNPDAN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry