AibGenesis™ Mouse Anti-ACP2 Antibody (CBMOAB-00297HCB)
Cat: CBMOAB-00297HCB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00297HCB | Monoclonal | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO00297HB | 100 µg | ||
| CBMOAB-1542FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO1542FC | 100 µg | ||
| CBMOAB-64696FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64696FYA | 100 µg | ||
| MO-AB-03338W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO03338W | 100 µg | ||
| MO-AB-06911R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06911R | 100 µg | ||
| MO-AB-12126W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12126W | 100 µg | ||
| MO-AB-50343W | Monoclonal | Marmoset | WB, ELISA | MO50343W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO00297HB |
| Specificity | This antibody binds to C. elegans ACP2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the histidine acid phosphatase family, which hydrolyze orthophosphoric monoesters to alcohol and phosphate. This protein is localized to the lysosomal membrane, and is chemically and genetically distinct from the red cell acid phosphatase. Mice lacking this gene showed multiple defects, including bone structure alterations, lysosomal storage defects, and an increased tendency towards seizures. An enzymatically-inactive allele of this gene in mice showed severe growth retardation, hair-follicle abnormalities, and an ataxia-like phenotype. Alternatively spliced transcript variants have been found for this gene. A C-terminally extended isoform is also predicted to be produced by the use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans ACP2 Antibody is a mouse antibody against ACP2. It can be used for ACP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein ACP-2; acp-2 |
| Gene ID | 174343 |
| UniProt ID | Q19461 |
| Protein Refseq | The length of the protein is 408 amino acids long. The sequence is show below: MKISWFLFICLIVQFAIALSENPKRIYTQVLFRHGARAPSNSLSDPAYLANFPRGLGELTDRGFENSFRLGRFLKTRYVDSKFVDGNLKPRQMYWRSVNKNRCLSSASTVGAAMFEDPSRHLYVPVLTEEIGENLLNYDQANCPRELELIKEKCPDFGGSFHPWTIYEEFIANCLKYTHPVFKQYPFHTIEAHINEYKNGIPLPPLIAQHINEIMGIYVNVTQFITGTGNHHDPRMMKVKFGNLMNTLLTDIKNKIYMDKEEKHKSDGRVSRREKLAVYSTQDWILMGVLDSLNVLEQTVGLDKYPEYNSMIIFETWKDNGKYFVKVFYKKEEITAEDHELIDVTKFVRNCKRERCLAQDFLDCCDDYRNKGEAESCEASDLKIRTTRSSPPNNIRRDLHVSEFSGPE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry