Mouse Anti-ACSF2 Antibody (MO-AB-06921R)


Cat: MO-AB-06921R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06921R Monoclonal Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO06921R 100 µg
CBMOAB-64715FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64715FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO06921R
SpecificityThis antibody binds to Cattle ACSF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ACSF2 Antibody is a mouse antibody against ACSF2. It can be used for ACSF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcyl-CoA synthetase family member 2, mitochondrial; EC 6.2.1.-; ACSF2
UniProt IDQ17QJ1
Protein RefseqThe length of the protein is 615 amino acids long.
The sequence is show below: MAVYVGMLRVARLCARSPRVLGARVGLSRVWQEARLWGVRPLSSGELDHTVPLPVGGFSYVQGHVGLHLSNKTVGRCLDATAQRVPDQEALVVHHENIRLTFAQLKEEVDKAASGLLSIGLRKGDRLGMWGPNSYAWVLMQLATAQAGIILVSVNPAYQAMELEYALKKVGCKALVFPKQFKTQQYYNILKQICPEVEKAQPGALKSQRLPDLTTVISVDAHLPGTLLLDEVVAAGSQEQNLTRLRHTQQFLSCH.
For Research Use Only | Not For Clinical Use.
Online Inquiry