AibGenesis™ Mouse Anti-Act87E Antibody (CBMOAB-00636FYA)


Cat: CBMOAB-00636FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00636FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster WB, ELISA MO00636FYA 100 µg
MOFAB-685W Monoclonal D. melanogaster 100 µg
MOFAB-732W Monoclonal D. melanogaster WB, IHC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster
CloneMO00636FYA
SpecificityThis antibody binds to fruit fly Act87E.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Act87E Antibody is a mouse antibody against Act87E. It can be used for Act87E detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin-87E; Act87E
UniProt IDP10981
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF.
For Research Use Only | Not For Clinical Use.
Online Inquiry