Mouse Anti-Act88F Antibody (CBMOAB-00637FYA)


Cat: CBMOAB-00637FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00637FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Lethocerus indicus WB, ELISA MO00637FYA 100 µg
Inquiry
MO-NAB-00728W Monoclonal D. melanogaster (Drosophila melanogaster), Lethocerus indicus WB NW0650 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Lethocerus indicus
CloneMO00637FYA
SpecificityThis antibody binds to fruit fly Act88F.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Required for proper formation of indirect flight muscle (IFM) myofibrils.
Product OverviewMouse Anti-D. melanogaster Act88F Antibody is a mouse antibody against Act88F. It can be used for Act88F detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin, indirect flight muscle; Actin-88F; Act88F
UniProt IDP83967
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVLSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF.
For Research Use Only | Not For Clinical Use.
Online Inquiry