Mouse Anti-ACYP2 Antibody (CBMOAB-35065FYA)
Cat: CBMOAB-35065FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35065FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) | WB, ELISA | MO35065FYA | 100 µg | ||
| CBMOAB-00673FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO00673FYA | 100 µg | ||
| MO-AB-09034W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09034W | 100 µg | ||
| MO-AB-14525W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14525W | 100 µg | ||
| MO-AB-28811W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28811W | 100 µg | ||
| MO-AB-41171W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41171W | 100 µg | ||
| MO-AB-43580W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43580W | 100 µg | ||
| MO-AB-50419W | Monoclonal | Marmoset | WB, ELISA | MO50419W | 100 µg | ||
| MO-AB-06981R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06981R | 100 µg | ||
| MO-AB-23522R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23522R | 100 µg | ||
| MO-AB-23968H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO23968C | 100 µg | ||
| MO-AB-32807H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32807C | 100 µg | ||
| MO-AB-07075Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07075Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) |
| Clone | MO35065FYA |
| Specificity | This antibody binds to Rhesus ACYP2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. |
| Product Overview | Mouse Anti-Rhesus ACYP2 Antibody is a mouse antibody against ACYP2. It can be used for ACYP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ACYP2 |
| UniProt ID | F6UFR3 |
| Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: GVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKIGSPSSRIDRTNFSNEKTISKLEYSNFSIRY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry