Mouse Anti-ACYP2 Antibody (CBMOAB-35065FYA)


Cat: CBMOAB-35065FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35065FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO35065FYA 100 µg
CBMOAB-00673FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO00673FYA 100 µg
MO-AB-09034W Monoclonal Cat (Felis catus) WB, ELISA MO09034W 100 µg
MO-AB-14525W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14525W 100 µg
MO-AB-28811W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28811W 100 µg
MO-AB-41171W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41171W 100 µg
MO-AB-43580W Monoclonal Horse (Equus caballus) WB, ELISA MO43580W 100 µg
MO-AB-50419W Monoclonal Marmoset WB, ELISA MO50419W 100 µg
MO-AB-06981R Monoclonal Cattle (Bos taurus) WB, ELISA MO06981R 100 µg
MO-AB-23522R Monoclonal Pig (Sus scrofa) WB, ELISA MO23522R 100 µg
MO-AB-23968H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23968C 100 µg
MO-AB-32807H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO32807C 100 µg
MO-AB-07075Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07075Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO35065FYA
SpecificityThis antibody binds to Rhesus ACYP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAcylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ACYP2 Antibody is a mouse antibody against ACYP2. It can be used for ACYP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACYP2
UniProt IDF6UFR3
Protein RefseqThe length of the protein is 80 amino acids long.
The sequence is show below: GVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKIGSPSSRIDRTNFSNEKTISKLEYSNFSIRY.
For Research Use Only | Not For Clinical Use.
Online Inquiry