Mouse Anti-ADA Antibody (MO-AB-06983R)
Cat: MO-AB-06983R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-06983R | Monoclonal | Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), E. coli, E. coli (Escherichia coli ), Fruit fly (Drosophila melanogaster), Zebrafish (Danio rerio) | WB, ELISA | MO06983R | 100 µg | ||
| CBMOAB-0038YC | Monoclonal | E. coli (Escherichia coli ) | WB, ELISA | MO0038YC | 100 µg | ||
| CBMOAB-00674FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO00674FYA | 100 µg | ||
| CBMOAB-64851FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64851FYA | 100 µg | ||
| MO-AB-13247W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13247W | 100 µg | ||
| MO-AB-28812W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28812W | 100 µg | ||
| MO-AB-00043Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00043Y | 100 µg | ||
| MOFAB-088W | Monoclonal | ELISA, IB | W1F5 | 100 µg | |||
| MOFY-0922-FY110 | Monoclonal | E. coli | WB, IP | MADA-1 | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), E. coli, E. coli (Escherichia coli ), Fruit fly (Drosophila melanogaster), Zebrafish (Danio rerio) |
| Clone | MO06983R |
| Specificity | This antibody binds to Cattle ADA. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Lysosome; Cytosol; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Involved in the adaptive response to alkylation damage in DNA caused by alkylating agents. Repairs O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme (Cys-321). Also specifically repairs the Sp diastereomer of DNA methylphosphotriester lesions by the same mechanism, although the methyl transfer occurs onto a different cysteine residue (Cys-38). Cannot demethylate the other diastereomer, Rp-methylphosphotriester. This is a suicide reaction: the enzyme is irreversibly inactivated. |
| Product Overview | Mouse Anti-Cattle ADA Antibody is a mouse antibody against ADA. It can be used for ADA detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Adenosine deaminase; EC 3.5.4.4; Adenosine aminohydrolase; ADA |
| UniProt ID | P56658 |
| Protein Refseq | The length of the protein is 363 amino acids long. The sequence is show below: MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQE. |
See other products for " ADA "
| CBMOAB-35069FYA | Mouse Anti-ADA Antibody (CBMOAB-35069FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry