Mouse Anti-adal Antibody (CBMOAB-64855FYA)


Cat: CBMOAB-64855FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-64855FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO64855FYA 100 µg
MO-AB-06986R Monoclonal Cattle (Bos taurus) WB, ELISA MO06986R 100 µg
MO-AB-18767W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18767W 100 µg
MO-AB-23970H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23970C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO64855FYA
SpecificityThis antibody binds to Zebrafish adal.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPutative nucleoside deaminase. May catalyze the hydrolytic deamination of adenosine or some similar substrate and play a role in purine metabolism. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish adal Antibody is a mouse antibody against adal. It can be used for adal detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenosine deaminase-like protein; EC 3.5.4.-; ada
UniProt IDQ4V9P6
Protein RefseqThe length of the protein is 348 amino acids long.
The sequence is show below: MDTEADLFYRQLPKVELHAHLNGSVSFETMEKLIKRKPHLNIEHSMTAIRRGQRRTLDECFQVFKVIHQLVDSEEDILMVAKSVIQEFAADGVKYLELRSTPREVTETGLSKQRYIETVLEAIRQCKQEGVDIDVRFLVAVDRRHGPEVAMQTVKLAEDFLLSSDGTVVGLDLSGDPTVGHGKDLLAALQKAKNCGLKLALHLSEVPSQIDETELLLNLPPDRIGHGTFLHPDVGGSDSLVDKVCKQNIPIEICLTSNVKGQTVPSYDKHHFKYWYNRGHPCVLCTDDKGVFCTDLSQEYQLAASTFGLTKEAVWILSQQAIGYTFAPEPIKQRLEKTWAELKQQILQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry