Mouse Anti-ADAM10 Antibody (CBMOAB-35074FYA)


Cat: CBMOAB-35074FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35074FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Pig (Sus scrofa) WB, ELISA MO35074FYA 100 µg
MO-AB-26147W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26147W 100 µg
MO-AB-28815W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28815W 100 µg
MO-AB-50421W Monoclonal Marmoset WB, ELISA MO50421W 100 µg
MO-AB-06988R Monoclonal Cattle (Bos taurus) WB, ELISA MO06988R 100 µg
MO-AB-23523R Monoclonal Pig (Sus scrofa) WB, ELISA MO23523R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Pig (Sus scrofa)
CloneMO35074FYA
SpecificityThis antibody binds to Rhesus ADAM10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMembers of the ADAM family are cell surface proteins with a unique structure possessing both potential adhesion and protease domains. This gene encodes an ADAM family member that cleaves many proteins including TNF-alpha and E-cadherin. Alternate splicing results in multiple transcript variants encoding different proteins that may undergo similar processing.
Product OverviewMouse Anti-Rhesus ADAM10 Antibody is a mouse antibody against ADAM10. It can be used for ADAM10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADAM10
UniProt IDF7GTR3
Protein RefseqThe length of the protein is 119 amino acids long.
The sequence is show below: MCPVFPVLRCCIFSTCRQTWLSINFYHKLKYIYFFQLPIKARRLDHLNIGDITCQCTYLVICRHVFLMYTVLLCAIVNRNCNMDVSLYYKIFPLLMKNYCLIDILRITENGGIQWSRIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry