Mouse Anti-ADAMTSL1 Antibody (CBMOAB-35165FYA)


Cat: CBMOAB-35165FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35165FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO35165FYA 100 µg
MO-AB-15693W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15693W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO35165FYA
SpecificityThis antibody binds to Rhesus ADAMTSL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins.
Product OverviewMouse Anti-Rhesus ADAMTSL1 Antibody is a mouse antibody against ADAMTSL1. It can be used for ADAMTSL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADAMTSL1
UniProt IDF7GZX2
Protein RefseqThe length of the protein is 683 amino acids long.
The sequence is show below: MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTALVVELAPKVLDGTRCYTESLDICISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDAVVAIPYGSRHVRLVLKGPDHLYLETKTLQGAKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSSDSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKPHIKEECIIPTPCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSTCTVTCGVGTQVRIVRCQVLLSFSQSVADLPVDECEGPKPASQRACYAGPCSGEIPEFNPDETDGLFGGLQDFDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTQEPADENLCVTSRRPPQLLKSCNLDPCPARSSINSAWKACKVLC.
For Research Use Only | Not For Clinical Use.
Online Inquiry