Mouse Anti-Adap2 Antibody (MO-AB-23972H)


Cat: MO-AB-23972H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23972H Monoclonal Rat (Rattus norvegicus), Pig (Sus scrofa) WB, ELISA MO23972C 100 µg
MO-AB-23537R Monoclonal Pig (Sus scrofa) WB, ELISA MO23537R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Pig (Sus scrofa)
CloneMO23972C
SpecificityThis antibody binds to Rat Adap2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene binds beta-tubulin and increases the stability of microtubules. The encoded protein can also translocate to the cell membrane and bind phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4). In addition, this protein is a GTPase-activating protein for ADP ribosylation factor 6 and may be able to block the entry of some RNA viruses.
Product OverviewThis product is a mouse antibody against Adap2. It can be used for Adap2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArf-GAP with dual PH domain-containing protein 2; Adap2
UniProt IDD3ZQG5
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: QEIVDWFNALRAARLQYLKLAFPDLPESELVPLITRNYLKQGFMEKTGPKHREPFKKRWFALDPQERRLLYYKNPLDAFEQGQVFLGSNEQGYEVWEGLPQGIRGNRWKVGLTVITPERKFVFTCPTEKEQREWLESLRGVLSSPLSPLHLLTTSAKSG.
See other products for " adap2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry