Mouse Anti-Adh Antibody (CBMOAB-00727FYA)


Cat: CBMOAB-00727FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00727FYA Monoclonal WB, ELISA MO00727FYA 100 µg
CBMOAB-1658FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO1658FC 100 µg
MO-AB-00035H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00035C 100 µg
MO-AB-34113H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34113C 100 µg
MO-AB-68771W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO68771W 100 µg
MO-DKB-0024RA Polyclonal WB 100 µL
MOFY-1222-FY185 Polyclonal Drosophila melanogaster WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); Rice (Oryza); P. vulgaris (Phaseolus vulgaris), Arabidopsis (Arabidopsis lyrata), Drosophila melanogaster, Silkworm (Bombyx mori), Tomato (Lycopersicon esculentum)
CloneMO00727FYA
SpecificityThis antibody binds to fruit fly Adh.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAlcohol dehydrogenase mostly active on ethanol (EtOH), but exhibits broad substrates selectivity for primary and secondary alcohols (e.g. butanol, propyl alcohol, pentanol, isopentanol, ethylene glycol, isopropanol, methanol and tertiary butyl alcohol) (PubMed:23707506). Converts allyl alcohol to highly toxic acryl-aldehyde (PubMed:20508152). Required for survival and acclimation in hypoxic conditions, especially in roots (PubMed:12857811, PubMed:9880346).
Product OverviewMouse Anti-D. melanogaster Adh Antibody is a mouse antibody against Adh. It can be used for Adh detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlcohol dehydrogenase; EC 1.1.1.1; Fragment; Adh
UniProt IDA0A077HCQ5
Protein RefseqThe length of the protein is 238 amino acids long.
The sequence is show below: MSFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHTFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry