Mouse Anti-Adh1 Antibody (MO-AB-27241W)
Cat: MO-AB-27241W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-27241W | Monoclonal | Cottonwood (Populus deltoids), A. thaliana (Arabidopsis thaliana), Frog (Xenopus laevis), Maize (Zea mays), Rabbit (Oryctolagus cuniculus), Yeast | WB, ELISA | MO27241W | 100 µg | ||
| CBMOAB-1659FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO1659FC | 100 µg | ||
| CBMOAB-00128CR | Monoclonal | Yeast | WB, ELISA | MO00128CR | 100 µg | ||
| MO-AB-47208W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO47208W | 100 µg | ||
| MO-AB-01248H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01248C | 100 µg | ||
| MO-AB-07087Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07087Y | 100 µg | ||
| MO-DKB-03757W | Polyclonal | Yeast | ELISA, WB, IP | 100 µg | |||
| MO-DKB-03759W | Polyclonal | Yeast | ELISA, WB, IHC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cottonwood (Populus deltoids), A. thaliana (Arabidopsis thaliana), Frog (Xenopus laevis), Maize (Zea mays), Rabbit (Oryctolagus cuniculus), Yeast |
| Clone | MO27241W |
| Specificity | This antibody binds to Cottonwood Adh1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Alcohol dehydrogenase mostly active on ethanol (EtOH), but exhibits broad substrates selectivity for primary and secondary alcohols (e.g. butanol, propyl alcohol, pentanol, isopentanol, ethylene glycol, isopropanol, methanol and tertiary butyl alcohol) (PubMed:23707506). Converts allyl alcohol to highly toxic acryl-aldehyde (PubMed:20508152). Required for survival and acclimation in hypoxic conditions, especially in roots (PubMed:12857811, PubMed:9880346). |
| Product Overview | Mouse Anti-Cottonwood Adh1 Antibody is a mouse antibody against Adh1. It can be used for Adh1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Alcohol dehydrogenase 1; Adh1 |
| UniProt ID | B9VN35 |
| Protein Refseq | The length of the protein is 75 amino acids long. The sequence is show below: TGLGAALNVAKPKKGHTVAVFGLGAVGLAAAEGARLSGASRIIGVDLNPSRFNEAKKFGVTELVNPKDHDKPVQQ. |
See other products for " ADH1 "
| CBMOAB-18515FYB | Mouse Anti-ADH1 Antibody (CBMOAB-18515FYB) |
| MO-DKB-02556W | Rabbit Anti-ADH1 Antibody (MO-DKB-02556W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry