Mouse Anti-ADI1 Antibody (CBMOAB-00134CR)
Cat: CBMOAB-00134CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00134CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rice (Oryza), Zebrafish (Danio rerio) | WB, ELISA | MO00134CR | 100 µg | ||
CBMOAB-18520FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO18520FYB | 100 µg | ||
CBMOAB-46471FYC | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO46471FYC | 100 µg | ||
CBMOAB-65023FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65023FYA | 100 µg | ||
MO-AB-00013L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00013L | 100 µg | ||
MO-AB-02076W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02076W | 100 µg | ||
MO-AB-07050R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07050R | 100 µg | ||
MO-AB-07092Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07092Y | 100 µg | ||
MO-AB-08395W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08395W | 100 µg | ||
MO-AB-10602Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10602Y | 100 µg | ||
MO-AB-23559R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23559R | 100 µg | ||
MO-AB-23979H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO23979C | 100 µg | ||
MO-AB-26257W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26257W | 100 µg | ||
MO-AB-38425W | Monoclonal | Gorilla | WB, ELISA | MO38425W | 100 µg | ||
MO-AB-41177W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41177W | 100 µg | ||
MO-AB-42902W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO42902W | 100 µg | ||
MO-AB-50499W | Monoclonal | Marmoset | WB, ELISA | MO50499W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rice (Oryza), Zebrafish (Danio rerio) |
Clone | MO00134CR |
Specificity | This antibody binds to Yeast ADI1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). |
Product Overview | Mouse Anti-Yeast ADI1 Antibody is a mouse antibody against ADI1. It can be used for ADI1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 1, 2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54) (Acireductone dioxygenase; Fe(2+)-requiring); ARD; Fe-ARD; ADI1; YMR009W |
UniProt ID | Q03677 |
Protein Refseq | The length of the protein is 179 amino acids long. The sequence is show below: MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDVVNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVESGDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALINQY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry