Mouse Anti-Adk1 Antibody (CBMOAB-00734FYA)


Cat: CBMOAB-00734FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00734FYA Monoclonal Fruit fly (Drosophila melanogaster), Yeast WB, ELISA MO00734FYA 100 µg
CBMOAB-00135CR Monoclonal Yeast WB, ELISA MO00135CR 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Yeast
CloneMO00734FYA
SpecificityThis antibody binds to fruit fly Adk1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Adenylate kinase activity is critical for regulation of the phosphate utilization and the AMP de novo biosynthesis pathways.
Product OverviewMouse Anti-D. melanogaster Adk1 Antibody is a mouse antibody against Adk1. It can be used for Adk1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate kinase-1, isoform B; EC 2.7.1.48; EC 2.7.4.3; IP15219p; RE68908p; Adk1
UniProt IDQ8IQG9
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MLFMCHQRVMKKEAEEKLKAEELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTLTINAERDVDDIFLEVVQAIDCVLKKKQQNAAAQC.
See other products for " ADK1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry