AibGenesis™ Mouse Anti-ADORA2A Antibody (CBMOAB-35231FYA)
Cat: CBMOAB-35231FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35231FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO35231FYA | 100 µg | ||
| MO-AB-00015L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00015L | 100 µg | ||
| MO-AB-00060Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00060Y | 100 µg | ||
| MO-AB-01267H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01267C | 100 µg | ||
| MO-AB-07062R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07062R | 100 µg | ||
| MO-AB-07096Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07096Y | 100 µg | ||
| MO-AB-08903W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08903W | 100 µg | ||
| MO-AB-14097Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14097Y | 100 µg | ||
| MO-AB-21531W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21531W | 100 µg | ||
| MO-AB-23578R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23578R | 100 µg | ||
| MO-AB-28841W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28841W | 100 µg | ||
| MO-AB-32808H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32808C | 100 µg | ||
| MO-AB-34338W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34338W | 100 µg | ||
| MO-AB-41180W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41180W | 100 µg | ||
| MO-AB-43588W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43588W | 100 µg | ||
| MO-AB-50511W | Monoclonal | Marmoset | WB, ELISA | MO50511W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
| Clone | MO35231FYA |
| Specificity | This antibody binds to Rhesus ADORA2A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily, which is subdivided into classes and subtypes. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein, an adenosine receptor of A2A subtype, uses adenosine as the preferred endogenous agonist and preferentially interacts with the G(s) and G(olf) family of G proteins to increase intracellular cAMP levels. It plays an important role in many biological functions, such as cardiac rhythm and circulation, cerebral and renal blood flow, immune function, pain regulation, and sleep. It has been implicated in pathophysiological conditions such as inflammatory diseases and neurodegenerative disorders. Alternative splicing results in multiple transcript variants. A read-through transcript composed of the upstream SPECC1L (sperm antigen with calponin homology and coiled-coil domains 1-like) and ADORA2A (adenosine A2a receptor) gene sequence has been identified, but it is thought to be non-coding. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ADORA2A Antibody is a mouse antibody against ADORA2A. It can be used for ADORA2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Adenosine receptor A2; ADORA2A |
| UniProt ID | F6X9B3 |
| Protein Refseq | The length of the protein is 139 amino acids long. The sequence is show below: MDRELAQPASVLSLPVCGPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry