Mouse Anti-ADRA1B Antibody (CBMOAB-35257FYA)


Cat: CBMOAB-35257FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35257FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa) WB, ELISA MO35257FYA 100 µg
MO-AB-07076R Monoclonal Cattle (Bos taurus) WB, ELISA MO07076R 100 µg
MO-AB-23584R Monoclonal Pig (Sus scrofa) WB, ELISA MO23584R 100 µg
MO-AB-28848W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28848W 100 µg
MO-AB-41182W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41182W 100 µg
MO-AB-50524W Monoclonal Marmoset WB, ELISA MO50524W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa)
CloneMO35257FYA
SpecificityThis antibody binds to Rhesus ADRA1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAlpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. This gene encodes alpha-1B-adrenergic receptor, which induces neoplastic transformation when transfected into NIH 3T3 fibroblasts and other cell lines. Thus, this normal cellular gene is identified as a protooncogene. This gene comprises 2 exons and a single large intron of at least 20 kb that interrupts the coding region.
Product OverviewMouse Anti-Rhesus ADRA1B Antibody is a mouse antibody against ADRA1B. It can be used for ADRA1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADRA1B
UniProt IDF6U596
Protein RefseqThe length of the protein is 518 amino acids long.
The sequence is show below: MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEAPGRRGRHDSGQLFTFKLLAEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF.
For Research Use Only | Not For Clinical Use.
Online Inquiry