Mouse Anti-AE1 Antibody (MO-AB-00069Y)


Cat: MO-AB-00069Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00069Y Monoclonal Chicken (Gallus gallus), Maize (Zea mays) WB, ELISA MO00069Y 100 µg
Inquiry
MO-AB-47291W Monoclonal Maize (Zea mays) WB, ELISA MO47291W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChicken (Gallus gallus), Maize (Zea mays)
CloneMO00069Y
SpecificityThis antibody binds to Chicken AE1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against AE1. It can be used for AE1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAE1 protein; AE1
UniProt IDQ90651
Protein RefseqThe length of the protein is 65 amino acids long. The sequence is show below: GSYDVDGRRHEVGAPPGRDGGRGQNPLVSDVDLEAAGSRQPTAHRDTYEGYVELHELVLDSRKDP.
For Research Use Only | Not For Clinical Use.
Online Inquiry