Mouse Anti-AE1 Antibody (MO-AB-00069Y)
Cat: MO-AB-00069Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chicken (Gallus gallus), Maize (Zea mays) |
Clone | MO00069Y |
Specificity | This antibody binds to Chicken AE1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | This product is a mouse antibody against AE1. It can be used for AE1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | AE1 protein; AE1 |
UniProt ID | Q90651 |
Protein Refseq | The length of the protein is 65 amino acids long. The sequence is show below: GSYDVDGRRHEVGAPPGRDGGRGQNPLVSDVDLEAAGSRQPTAHRDTYEGYVELHELVLDSRKDP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry