AibGenesis™ Mouse Anti-AGBL3 Antibody (CBMOAB-35307FYA)


Cat: CBMOAB-35307FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35307FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO35307FYA 100 µg
MO-AB-07100R Monoclonal Cattle (Bos taurus) WB, ELISA MO07100R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO35307FYA
SpecificityThis antibody binds to Rhesus AGBL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus AGBL3 Antibody is a mouse antibody against AGBL3. It can be used for AGBL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAGBL3
UniProt IDF7HTY6
Protein RefseqThe length of the protein is 172 amino acids long.
The sequence is show below: MSEDSEKEDYSDRTISDEDESDEDMFMKFVSEDFHRCALLTADSFGDPFFPRTTQILLEYQLGRWVPRLREPRDLYGVSSSGPLSPTRWPYHCEVIDEKVQHIDGVSRCHQAGVQWCNLGSLQPPPSRFKPFSCFSLLSSWDYRHTPPHPANFFLVETGFHVGQDGLHLLTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry