AibGenesis™ Mouse Anti-AGBL4 Antibody (CBMOAB-35309FYA)


Cat: CBMOAB-35309FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35309FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO35309FYA 100 µg
CBMOAB-65178FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65178FYA 100 µg
MO-AB-23992H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23992C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO35309FYA
SpecificityThis antibody binds to Rhesus AGBL4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus AGBL4 Antibody is a mouse antibody against AGBL4. It can be used for AGBL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAGBL4
UniProt IDF7GRB8
Protein RefseqThe length of the protein is 492 amino acids long.
The sequence is show below: GNDMGNDDAIGGNVSKYIVLPTGYCGQPKKGHLLFDACFESGNLGRVDQVSEFEYDLFIRPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPKNVYYYRCPDHRKNYVMSFAFCFDREEDIYQFAYCYPYTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRQLDLLTITSPDNLREGAEQKVVFITGRVHPGETPSSFVCQGIIDFLVSQHPIARVLREYLVFKIAPMLNPDGVYLGNYRCSLMGFDLNRHWLDPSPWVHPTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLCQNDEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTEEAYMKLGRNVARTFLDYYRLNPMVEKVAIPMPRLRNKEIEVQRRKEKSPPYKHPLLRGPASNYPNGKGDKKSSVNHKDPSTPF.
For Research Use Only | Not For Clinical Use.
Online Inquiry