AibGenesis™ Mouse Anti-AGMAT Antibody (CBMOAB-35321FYA)
Cat: CBMOAB-35321FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35321FYA | Monoclonal | Rhesus (Macaca mulatta), Chicken, Human, Mouse, Rat, Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio) | WB, ELISA | MO35321FYA | 100 µg | ||
| CBMOAB-65203FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65203FYA | 100 µg | ||
| MO-AB-01289H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01289C | 100 µg | ||
| MO-AB-20180W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20180W | 100 µg | ||
| MOFAB-792W | Monoclonal | Chicken, Human, Mouse, Rat | WB, IHC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chicken, Human, Mouse, Rat, Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio) |
| Clone | MO35321FYA |
| Specificity | This antibody binds to Rhesus AGMAT. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus AGMAT Antibody is a mouse antibody against AGMAT. It can be used for AGMAT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Agmatinase, mitochondrial; AGMAT |
| UniProt ID | H9FC66 |
| Protein Refseq | The length of the protein is 43 amino acids long. The sequence is show below: GLNVVGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry