AibGenesis™ Mouse Anti-AGPAT1 Antibody (CBMOAB-35324FYA)
Cat: CBMOAB-35324FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35324FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Sheep (Ovis aries) | WB, ELISA | MO35324FYA | 100 µg | ||
| MO-AB-01291H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01291C | 100 µg | ||
| MO-AB-02090W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02090W | 100 µg | ||
| MO-AB-07129R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07129R | 100 µg | ||
| MO-AB-14136Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14136Y | 100 µg | ||
| MO-AB-15035W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15035W | 100 µg | ||
| MO-AB-23627R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23627R | 100 µg | ||
| MO-AB-34348W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34348W | 100 µg | ||
| MO-DKB-01406W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Sheep (Ovis aries) |
| Clone | MO35324FYA |
| Specificity | This antibody binds to Rhesus AGPAT1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus AGPAT1 Antibody is a mouse antibody against AGPAT1. It can be used for AGPAT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | AGPAT1 |
| UniProt ID | F6V4Q6 |
| Protein Refseq | The length of the protein is 171 amino acids long. The sequence is show below: MMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry