AibGenesis™ Mouse Anti-AGPAT4 Antibody (CBMOAB-35331FYA)


Cat: CBMOAB-35331FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35331FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO35331FYA 100 µg
CBMOAB-65219FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65219FYA 100 µg
MO-AB-01294H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01294C 100 µg
MO-AB-02094W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02094W 100 µg
MO-AB-07132R Monoclonal Cattle (Bos taurus) WB, ELISA MO07132R 100 µg
MO-AB-14962W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14962W 100 µg
MO-AB-23632R Monoclonal Pig (Sus scrofa) WB, ELISA MO23632R 100 µg
MO-AB-50599W Monoclonal Marmoset WB, ELISA MO50599W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO35331FYA
SpecificityThis antibody binds to Rhesus AGPAT4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. (From NCBI)
Product OverviewMouse Anti-Rhesus AGPAT4 Antibody is a mouse antibody against AGPAT4. It can be used for AGPAT4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAGPAT4
UniProt IDF6PNV1
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MDLAGLLKSQFLCHLVFCYVFIASGLIINTVQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYPKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFVRRHQSSCRFLFLFAFSSQIKTLGLREVKERVQSGRRKGGIEITELCELFSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDRCSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASMGVRWMIGVTEIDKGSAYGNSDSKQKQND.
For Research Use Only | Not For Clinical Use.
Online Inquiry