AibGenesis™ Mouse Anti-AGPAT9 Antibody (CBMOAB-35334FYA)


Cat: CBMOAB-35334FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35334FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO35334FYA 100 µg
CBMOAB-65226FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65226FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO35334FYA
SpecificityThis antibody binds to Rhesus AGPAT9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionConverts glycerol-3-phosphate to 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) by incorporating an acyl moiety at the sn-1 position of the glycerol backbone. Also converts LPA into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus AGPAT9 Antibody is a mouse antibody against AGPAT9. It can be used for AGPAT9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlycerol-3-phosphate acyltransferase 3; AGPAT9
UniProt IDH9F5E2
Protein RefseqThe length of the protein is 133 amino acids long.
The sequence is show below: PEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDTLKEEQQKNYSKMIVGNGSVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry