Mouse Anti-agps Antibody (CBMOAB-65231FYA)


Cat: CBMOAB-65231FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-65231FYA Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO65231FYA 100 µg
MO-AB-01295H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01295C 100 µg
MO-AB-23997H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23997C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO65231FYA
SpecificityThis antibody binds to Zebrafish agps.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the FAD-binding oxidoreductase/transferase type 4 family. It encodes a protein that catalyzes the second step of ether lipid biosynthesis in which acyl-dihydroxyacetonephosphate (DHAP) is converted to alkyl-DHAP by the addition of a long chain alcohol and the removal of a long-chain acid anion. The protein is localized to the inner aspect of the peroxisomal membrane and requires FAD as a cofactor. Mutations in this gene have been associated with rhizomelic chondrodysplasia punctata, type 3 and Zellweger syndrome.
Product OverviewMouse Anti-Zebrafish agps Antibody is a mouse antibody against agps. It can be used for agps detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAgps protein; Alkylglycerone phosphate synthase; agp
UniProt IDQ7ZVJ9
Protein RefseqThe length of the protein is 629 amino acids long.
The sequence is show below: MASNGSSSSSRSQHRLRIIAGHLQKRTEDQHTSLSAQNCRAESPGSSPSRQTPVPRRRQEIMKWNGWGYSDSRFLFNKKGQAEFTGKRYRLSGLILPSLKDWFEGTFGASLQHKSPATSSLNVSAVSPPNLNEAFSEDLKAAGLLASHDAEDRVFRAHGHCLHEIFALREGRIGRVPDMVVWPSCHSDVEKIVDLACKHNVCLIPYGGGTSVSSALECPQEETRCIVSLDTSQMNRILWIDEKNLTAHVEAGIIGQDLERQLNERGYCTGHEPDSMEFSSLGGWVATRASGMKKNIYGNIEDLVVHIKMVTPRGVIEKSCLGPRMSTGPDIHHFIMGSEGTLGVVTEVTMKIRPIPEYQKYGSVVFPNFQQGVACLREVARQRCAPASIRLMDNEQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPHHLCVATLLFEGDRGKVLQHEKQVYDIAAKFGGLAAGEDNGQRGYMLTFVIAYLRDLGMDYYVIDESFETSVPWDRVLDLCRNVKERIIRECKERGVQFPPLSTCRVTQTYDAGACVYFYFAFNYRGLSDPVHVYEQVEHAAREEILANGGSLSHHHGVGKLRKEWMKESVSGVGLGMIQSVKEFVDPQNIFGSRNLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry