AibGenesis™ Mouse Anti-AGR2 Antibody (CBMOAB-35337FYA)


Cat: CBMOAB-35337FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35337FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO35337FYA 100 µg
CBMOAB-65232FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65232FYA 100 µg
MO-AB-07137R Monoclonal Cattle (Bos taurus) WB, ELISA MO07137R 100 µg
MO-AB-23998H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23998C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO35337FYA
SpecificityThis antibody binds to Rhesus AGR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. (From NCBI)
Product OverviewMouse Anti-Rhesus AGR2 Antibody is a mouse antibody against AGR2. It can be used for AGR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAGR2
UniProt IDF7HNR1
Protein RefseqThe length of the protein is 175 amino acids long.
The sequence is show below: MEKISVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRILFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry