AibGenesis™ Mouse Anti-AHSA2 Antibody (CBMOAB-35367FYA)


Cat: CBMOAB-35367FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35367FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO35367FYA 100 µg
MO-AB-03358W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03358W 100 µg
MO-AB-07155R Monoclonal Cattle (Bos taurus) WB, ELISA MO07155R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO35367FYA
SpecificityThis antibody binds to Rhesus AHSA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus AHSA2 Antibody is a mouse antibody against AHSA2. It can be used for AHSA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActivator of 90 kDa heat shock protein ATPase homolog 2; AHSA2
UniProt IDI2CTW8
Protein RefseqThe length of the protein is 138 amino acids long.
The sequence is show below: MILPAKAMATQELTVKRKPSENTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIFTVKDLTNKKIVMKWRCKNWPEEHYATVALNFVPTLGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIKGLLQLTPLNG.
For Research Use Only | Not For Clinical Use.
Online Inquiry