Mouse Anti-AICDA Antibody (CBMOAB-35371FYA)


Cat: CBMOAB-35371FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35371FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO35371FYA 100 µg
CBMOAB-65306FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65306FYA 100 µg
MO-AB-01310H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01310C 100 µg
MO-AB-07127Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07127Y 100 µg
MO-AB-07160R Monoclonal Cattle (Bos taurus) WB, ELISA MO07160R 100 µg
MO-AB-15355W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15355W 100 µg
MO-AB-24005H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24005C 100 µg
MO-AB-28900W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28900W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO35371FYA
SpecificityThis antibody binds to Rhesus AICDA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2).
Product OverviewMouse Anti-Rhesus AICDA Antibody is a mouse antibody against AICDA. It can be used for AICDA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAICDA
UniProt IDF7GR23
Protein RefseqThe length of the protein is 182 amino acids long.
The sequence is show below: MNRRKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIAIMTFKGAKGPSAQAQCSSPHSGLRCRTNESVGKHQGKKWAGILVHLWSRN.
For Research Use Only | Not For Clinical Use.
Online Inquiry