AibGenesis™ Mouse Anti-AIFM1 Antibody (CBMOAB-35377FYA)
Cat: CBMOAB-35377FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35377FYA | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Cow, Human, Mouse, Rat, Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) | WB, ELISA | MO35377FYA | 100 µg | ||
| CBMOAB-65316FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65316FYA | 100 µg | ||
| MO-AB-17245W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17245W | 100 µg | ||
| MO-AB-23650R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23650R | 100 µg | ||
| MO-AB-50622W | Monoclonal | Marmoset | WB, ELISA | MO50622W | 100 µg | ||
| MOFAB-764W | Monoclonal | Cow, Human, Mouse, Rat | WB, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Cow, Human, Mouse, Rat, Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) |
| Clone | MO35377FYA |
| Specificity | This antibody binds to Rhesus AIFM1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6 (COXPD6), a severe mitochondrial encephalomyopathy, as well as Cowchock syndrome, also known as X-linked recessive Charcot-Marie-Tooth disease-4 (CMTX-4), a disorder resulting in neuropathy, and axonal and motor-sensory defects with deafness and cognitive disability. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 10. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus AIFM1 Antibody is a mouse antibody against AIFM1. It can be used for AIFM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | AIFM1 |
| UniProt ID | F7C728 |
| Protein Refseq | The length of the protein is 326 amino acids long. The sequence is show below: MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPRSATEQSGTGIRSESETESEASEIAIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED. |
For Research Use Only | Not For Clinical Use.
Online Inquiry