AibGenesis™ Mouse Anti-Aim2 Antibody (MO-AB-24011H)


Cat: MO-AB-24011H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24011H Monoclonal Rat (Rattus norvegicus), Yeast WB, ELISA MO24011C 100 µg
CBMOAB-00176CR Monoclonal Yeast WB, ELISA MO00176CR 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Yeast
CloneMO24011C
SpecificityThis antibody binds to Rat Aim2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against Aim2. It can be used for Aim2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Aim2; Aim2
UniProt IDM0R7W9
Protein RefseqThe length of the protein is 120 amino acids long.
The sequence is show below: MESDFREMLLLTGLDHITEEELKRFKYLALTEFNIPRKTLNIADRTELADQLIQSAGAASAVAKAISIFQKLNYMDIAKALEEKKKEASEETDGGRTGSHQRRFTARFTSSHGAESYESL.
See other products for " AIM2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry