Mouse Anti-AK5 Antibody (CBMOAB-35400FYA)


Cat: CBMOAB-35400FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35400FYA Monoclonal Rhesus (Macaca mulatta), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO35400FYA 100 µg
CBMOAB-1983FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO1983FC 100 µg
CBMOAB-65348FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65348FYA 100 µg
MO-AB-21173W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21173W 100 µg
MO-AB-50642W Monoclonal Marmoset WB, ELISA MO50642W 100 µg
MO-AB-07177R Monoclonal Cattle (Bos taurus) WB, ELISA MO07177R 100 µg
MO-AB-23654R Monoclonal Pig (Sus scrofa) WB, ELISA MO23654R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO35400FYA
SpecificityThis antibody binds to Rhesus AK5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Product OverviewMouse Anti-Rhesus AK5 Antibody is a mouse antibody against AK5. It can be used for AK5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAK5
UniProt IDF6V948
Protein RefseqThe length of the protein is 241 amino acids long.
The sequence is show below: MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQYSLCPQTKMPMQSDPLPYAAPYRACPVHQDSP.
For Research Use Only | Not For Clinical Use.
Online Inquiry